PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0029s0600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 160aa    MW: 17659 Da    PI: 8.5691
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0029s0600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.5e-393996259
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                            +ek ++cprC+s++tkfCy+nny+++qPryfCk+C+ryWt+GGalrnvPvG+grrk k
  SapurV1A.0029s0600.1.p 39 PEKLIPCPRCKSMETKFCYFNNYNINQPRYFCKGCQRYWTAGGALRNVPVGAGRRKTK 96
                            67899***************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-283896IPR003851Zinc finger, Dof-type
PfamPF027017.8E-324196IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.1554397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MACQEEGIKL FGATITMHDK QEGDKEDPNK EDPTIDKRPE KLIPCPRCKS METKFCYFNN  60
YNINQPRYFC KGCQRYWTAG GALRNVPVGA GRRKTKPPGL VGLDGYSEGC LYDGSGGVHL  120
FGLDGVVLED WHLATTHGSF RHVFPVKRRR SGGSGGQTC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011008472.11e-108PREDICTED: dof zinc finger protein DOF1.5-like
SwissprotP683508e-59DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLB9H2I31e-107B9H2I3_POPTR; Dof zinc finger protein DOF2.3
STRINGPOPTR_0004s05580.11e-107(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64833251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.15e-60Dof family protein